OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TCF7L2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA333645
Rabbit Polyclonal Anti-TCF7L2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY431517 Transient overexpression lysate of transcription factor 7-like 2 (T-cell specific, HMG-box) (TCF7L2), transcript variant 1 (as WB positive control) 100 ug
$436.00

View other "TCF7L2 or NM_030756" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 65 kDa
Gene Name transcription factor 7 like 2
Database Link
Background The TCL7L2 is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. suggested that TCL7L2 acts through regulation of proglucagon through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway. The TCL7L2 gene product is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. (2005) PubMed 15525634 suggested that TCL7L2 acts through regulation of proglucagon (MIM 138030) through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway. supplied by OMIM. Sequence Note: This gene (TCF7L2, alias TCF-4) is distinct from TCF4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-202 DA473655.1 1-202 203-251 Y11306.2 3-51 252-1252 AK225809.1 256-1256 1253-1305 Y11306.2 1053-1105 1306-1756 AK225809.1 1310-1760 1757-1811 Y11306.2 1557-1611 1812-2652 AK225809.1 1765-2605
Synonyms TCF-4; TCF4
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 79%
Reference Data
Protein Categories Endocrine and metabolic diseases, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Acute myeloid leukemia, Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Melanogenesis, Pathways in cancer, Prostate cancer, Thyroid cancer, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

4D Nucleome-Guided Cellular Reprogramming
Dotson
Thesis (2022)
Snippet: Fisher;NP00061) and an XCell II Blot Module. Membranes were incubated with antibodies targeting TCF4 (Origene;TA333645), active β-catenin (Millipore;05-665), or β-actin (CST;4970S). An HRP-secondary antibody (CST;7074S, 7076S) was applied and detected using Pierce ECL Western Blotting Substrate (Thermo Scientific;32209). Blots were imaged in an Azure c600 Gel Imaging Station (Azure Biosystems)
WB
TCF7L2 silencing results in altered gene expression patterns accompanied by local genomic reorganization
Brown, Dotson, Ronquist et al
Neoplasia (2021) 23 (2), 257-269 DOI: 10.1016/j.neo.2020.12.010
Cited by 10
AI Summary: OriGene contributed to this study by providing the TCF4 antibody (TA333645), which was used for Western blot analysis to detect TCF4 protein levels following gene silencing experiments.
Snippet: teins were transferred into a PVDF membrane (Millipore;IPVH00010) using Transfer Buffer (Thermo Fisher;NP00061) and an XCell II Blot Module. Membranes were incubated with antibodies targeting TCF4 (Origene;TA333645), active β-catenin (Millipore;05-665), or β-actin (CST;4970S). An HRP-linked secondary antibody (CST;7074S, 7076S) was applied and detected using Pierce ECL Western Blotting Sub
FigureFigureFigure
WB
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products