PLA2G12B Rabbit Polyclonal Antibody

CAT#: TA333609

Rabbit Polyclonal Anti-PLA2G12B Antibody

Product Images

Host: Rabbit; Target Name: PLA2G12B; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: phospholipase A2 group XIIB
• Database Link:
  NP_115951
  Entrez Gene 84647 Human
  UniProt ID Q9BX93
• Background: Phospholipase A2 (PLA2) enzymes catalyze hydrolysis of glycolipids to release free fatty acids and lysophospholipids. PLA2G12B belongs to the PLA2 family, but it is catalytically inactive due to an amino acid change in its active site and has altered phospholipid-binding properties.
• Synonyms: FKSG71; GXIIB; GXIIIsPLA2; PLA2G13; sPLA2-GXIIB
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 79%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway