SLC35A4 Rabbit Polyclonal Antibody

SKU TA333556

Rabbit Polyclonal Anti-SLC35A4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35A4 Antibody: synthetic peptide directed towards the middle region of human SLC35A4. Synthetic peptide located within the following region: GLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: solute carrier family 35 member A4
• Database Link:
  NP_542401
  Q96G79
• Background: The function of this protein remains unknown.
• Synonyms: MGC2541
• Note: Immunogen sequence homology: Human: 100%; Yeast: 100%; Horse: 87%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transmembrane