Tpgs1 Rabbit Polyclonal Antibody

SKU TA333491

Rabbit Polyclonal Anti-Tpgs1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tpgs1 Antibody is: synthetic peptide directed towards the middle region of Mouse Tpgs1. Synthetic peptide located within the following region: DGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGIFRTGMLSC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: tubulin polyglutamylase complex subunit 1
• Database Link:
  NP_683736
  Q99MS8
• Background: Tpgs1 may act in the targeting of the tubulin polyglutamylase complex. It is required for the development of the spermatid flagellum.
• Synonyms: AV005629; Gm16517; Gtrgeo22; PGs1
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Rabbit: 77%

Reference Data