OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COL6A5 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA333468
Rabbit Polyclonal Anti-COL6A5 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "COL6A5 or NM_153264" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-COL6A5 Antibody is: synthetic peptide directed towards the C-terminal region of Human COL6A5. Synthetic peptide located within the following region: RNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPLDHHLVQLGRTHKPD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 62 kDa
Gene Name collagen type VI alpha 5
Database Link
Background The protein encoded by this gene is a collagen that contains N- and C-terminal von Willebrand factor A-like domains. The encoded protein may interact with the alpha 1 and alpha 2 chains of collagen VI to form the complete collagen VI trimer. Sequence polymorphisms in this gene have been linked to atopic dermatitis (eczema). Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene.
Synonyms COL29A1; VWA4
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Rabbit: 79%
Reference Data
Protein Categories Allergies and autoimmune diseases, Intracellular Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products