SLC24A4 Rabbit Polyclonal Antibody

CAT#: TA333465

Rabbit Polyclonal Anti-SLC24A4 Antibody

Product Images

WB Suggested Anti-SLC24A4 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC24A4 Antibody: synthetic peptide directed towards the N terminal of human SLC24A4. Synthetic peptide located within the following region: PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: solute carrier family 24 member 4
• Database Link:
  NP_705932
  Entrez Gene 123041 Human
  UniProt ID Q8NFF2
• Background: Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions (Li et al., 2002 [PubMed 12379639]).
• Synonyms: AI2A5; NCKX4; SHEP6; SLC24A2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane