Eras Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Eras Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 25 kDa |
| Gene Name | ES cell-expressed Ras |
| Database Link | |
| Background | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Eras plays an important role in the tumor-like growth properties of embryonic stem cells. |
| Synonyms | E-Ras; HRAS2; HRASP; MGC126691; MGC126693 |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 92% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
ERAS Is Constitutively Expressed in the Tissues of Adult Horses and May Be a Key Player in Basal Autophagy
De Falco, Perillo, Del Piero et al
Front Vet Sci (2022) 9, 818294 DOI: 10.3389/fvets.2022.818294
De Falco, Perillo, Del Piero et al
Front Vet Sci (2022) 9, 818294 DOI: 10.3389/fvets.2022.818294
Cited by 3
AI Summary: OriGene products, specifically the anti-human embryonic stem cell-expressed Ras (ERAS) antibody (TA324562) and the ERAS HEK 293T cell transient overexpression lysate and Western blot positive control (LC405694), were used in this study to detect and validate ERAS protein expression in horse tissues, supporting the investigation of ERAS’s physiological role.
Snippet: nst human embryonic stem cell-expressed Ras (ERAS) (TA324562), diluted 1:1000 in BSA, with ERAS HEK 293T cell transient overexpression lysate and WB positive control (COD. LC405694) was obtained from OriGene Technologies, Inc. (MD, USA). This specific antibody was produced against a human ERAS epitope composed of 31 amino acid residues at position 51–81. The human epitope revealed a 100% identit
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
