TMCO4 Rabbit Polyclonal Antibody

CAT#: TA333410

Rabbit Polyclonal Anti-TMCO4 Antibody

Product Images

WB Suggested Anti-TMCO4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMCO4 Antibody: synthetic peptide directed towards the C terminal of human TMCO4. Synthetic peptide located within the following region: WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: transmembrane and coiled-coil domains 4
• Database Link:
  NP_859070
  Entrez Gene 255104 Human
  UniProt ID Q5TGY1
• Background: The function of TMCO4 remains unknown.
• Synonyms: RP5-1056L3.6
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Transmembrane