OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IGFL2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA332341
Rabbit Polyclonal Anti-IGFL2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY424111 Transient overexpression lysate of IGF-like family member 2 (IGFL2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP325054 Purified recombinant protein of Human IGF-like family member 2 (IGFL2), transcript variant 2,full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
20 ug
$867.00

View other "IGFL2 or NM_001002915" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-IGFL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human IGFL2. Synthetic peptide located within the following region: QCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCES
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 14 kDa
Gene Name IGF like family member 2
Database Link
Background IGFL2 belongs to the insulin-like growth factor family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth.
Synonyms UNQ645; VPRI645
Note Immunogen sequence homology: Human: 100%; Rabbit: 92%
Reference Data
Protein Categories Growth Factors, Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products