POTEA Rabbit Polyclonal Antibody

SKU TA332284

Rabbit Polyclonal Anti-POTEA Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-POTEA Antibody is: synthetic peptide directed towards the C-terminal region of Human POTEA. Synthetic peptide located within the following region: EKVTQEPDINKDCDREVEEEMQKHGSNNVGLSENLTDGAAAGNGDGGLVP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: POTE ankyrin domain family member A
• Database Link:
  NP_001005365
  Q6S8J7
• Background: The function of this protein remains unknown.
• Synonyms: A26A1; CT104.3; POTE-8; POTE8
• Note: Immunogen sequence homology: Human: 100%; Yeast: 91%

Reference Data