Polyserase3 (PRSS53) Rabbit Polyclonal Antibody

CAT#: TA332237

Rabbit Polyclonal Anti-PRSS53 Antibody

Product Images

Host: Rabbit; Target Name: PRSS53; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRSS53 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRSS53. Synthetic peptide located within the following region: GATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAHIC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: protease, serine 53
• Database Link:
  NP_001034592
  Entrez Gene 339105 Human
  UniProt ID Q2L4Q9
• Background: PRSS53 in vitro can degrade the fibrinogen alpha chain of as well as pro-urokinase-type plasminogen activator.
• Synonyms: POL3S; UNQ308
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 92%; Rabbit: 79%