GOT2 Rabbit Polyclonal Antibody

CAT#: TA332130

Rabbit Polyclonal Anti-GOT2 Antibody

Product Images

WB Suggested Anti-GOT2 Antibody; Titration: 1 ug/ml; Positive Control: 293T Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: glutamic-oxaloacetic transaminase 2
• Database Link:
  NP_002071
  Entrez Gene 2806 Human
  UniProt ID P00505
• Background: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: KAT4; KATIV; mitAAT
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Cysteine and methionine metabolism, Metabolic pathways, Phenylalanine, tyrosine and tryptophan biosynthesis, Phenylalanine metabolism, Tyrosine metabolism