GOT2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 45 kDa |
| Gene Name | glutamic-oxaloacetic transaminase 2 |
| Database Link | |
| Background | Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Synonyms | KAT4; KATIV; mitAAT |
| Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Nervous system Diseases |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | Alanine, Arginine and proline metabolism, aspartate and glutamate metabolism, Cysteine and methionine metabolism, Metabolic pathways, Phenylalanine, Phenylalanine metabolism, tyrosine and tryptophan biosynthesis, Tyrosine metabolism |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
BOXR1030, an anti-GPC3 CAR with exogenous GOT2 expression, shows enhanced T cell metabolism and improved anti-cell line derived tumor xenograft activity
Hickman, Choi, Whiteman et al
PLoS One (2022) 17 (5), e0266980 DOI: 10.1371/journal.pone.0266980
Hickman, Choi, Whiteman et al
PLoS One (2022) 17 (5), e0266980 DOI: 10.1371/journal.pone.0266980
Cited by 33
AI Summary: OriGene’s rabbit anti-human GOT-2 polyclonal antibody (catalog #TA325088) was used for Western blot detection of GOT2 expression, enabling assessment of transgene expression and functional analysis in the study.
Snippet: … Aberrant GPC3 expression is implicated in tumorigenesis [30–32], and GPC3-positive cancers including hepatocellular carcinomas (HCC), are characterized by a highly metabolic and immunosuppressive landscape [33], and exhaustion is a common feat;Western blot antibodies for GOT2 detection were rabbit anti-human GOT-2 polyclonal antibody (Origene, catalog #TA325088) and HRP-conjugated AffiniPure Goat anti-rabbit IgG (ThermoFisher, catalog #G-21234). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
