PCYT2 Rabbit Polyclonal Antibody

SKU TA332113

Rabbit Polyclonal Anti-PCYT2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCYT2 Antibody: synthetic peptide directed towards the C terminal of human PCYT2. Synthetic peptide located within the following region: KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: phosphate cytidylyltransferase 2, ethanolamine
• Database Link:
  NP_002852
  Q99447
• Background: The function remains unknown.
• Synonyms: ET
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 92%; Bovine: 86%; Zebrafish: 77%

Reference Data

• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways