AP4B1 Rabbit Polyclonal Antibody

SKU TA332032

Rabbit Polyclonal Anti-AP4B1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AP4B1 Antibody is: synthetic peptide directed towards the C-terminal region of Human AP4B1. Synthetic peptide located within the following region: GAERCDPELPKTSSFAASGPLIPEENKERVQELPDSGALMLVPNRQLTAD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: adaptor related protein complex 4 beta 1 subunit
• Database Link:
  NP_006585
  Q9Y6B7
• Background: The function of this protein remains unknown.
• Synonyms: BETA-4; CPSQ5; SPG47
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 79%

Reference Data

• Protein Pathways: Lysosome