ARFIP2 Rabbit Polyclonal Antibody

SKU TA331996

Rabbit Polyclonal Anti-ARFIP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARFIP2 Antibody: synthetic peptide directed towards the N terminal of human ARFIP2. Synthetic peptide located within the following region: PEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHST
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: ADP ribosylation factor interacting protein 2
• Database Link:
  NP_036534
  P53365
• Background: ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.
• Synonyms: POR1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome