LEPROTL1 Rabbit Polyclonal Antibody

SKU TA331958

Rabbit Polyclonal Anti-LEPROTL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LEPROTL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human LEPROTL1. Synthetic peptide located within the following region: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 14 kDa
• Gene Name: leptin receptor overlapping transcript-like 1
• Database Link:
  NP_056159
  O95214
• Background: LEPROTL1 negatively regulates growth hormone (GH) receptor cell surface expression in liver. It may play a role in liver resistance to GH during periods of reduced nutrient availability.
• Synonyms: HSPC112; my047; Vps55
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane