ZNF692 Rabbit Polyclonal Antibody

SKU TA331880

Rabbit Polyclonal Anti-ZNF692 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF692 Antibody: synthetic peptide directed towards the N terminal of human ZNF692. Synthetic peptide located within the following region: GGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCAGPEPLPPKGLQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: zinc finger protein 692
• Database Link:
  NP_060335
  Q9BU19
• Background: ZNF692 may be involved in transcriptional regulation.
• Synonyms: AREBP; Zfp692
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data