OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF395 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA331849
Rabbit Polyclonal Anti-ZNF395 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY412967 Transient overexpression lysate of zinc finger protein 395 (ZNF395) (as WB positive control) 100 ug
$436.00

View other "ZNF395 or NM_018660" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF395 Antibody: synthetic peptide directed towards the C terminal of human ZNF395. Synthetic peptide located within the following region: GLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name zinc finger protein 395
Database Link
Background ZNF395 is a novel transcription factor shuttling between nucleus and cytoplasm and bind to the specific GCCGGCG, which is an essential cis-element for HD gene expression in neuronal cells. ZNF395 might play a role in transcription of PV genes and in E2-mediated repression.
Synonyms HDBP-2; HDBP2; HDRF-2; PBF; PRF-1; PRF1; Si-1-8-14
Note Immunogen sequence homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 85%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products