Hes6 Rabbit Polyclonal Antibody

CAT#: TA331840

Rabbit Polyclonal Anti-Hes6 Antibody

Product Images

WB Suggested Anti-Hes6 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Hes6 Antibody is: synthetic peptide directed towards the middle region of Mouse Hes6. Synthetic peptide located within the following region: LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: hairy and enhancer of split 6
• Database Link:
  NP_062352
  Entrez Gene 55927 Mouse
  UniProt ID Q9JHE6
• Background: Hes6 does not bind DNA itself but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Hes6 also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowing ASCL1 and TCF3 to up-regulate transcription in its presence. It promotes cell differentiation.
• Synonyms: bHLHb41; bHLHc23; C-HAIRY1; HES-6
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Horse: 75%; Rabbit: 75%