PRAMEF1 Rabbit Polyclonal Antibody

CAT#: TA331764

Reviews ()
Write a review

Rabbit Polyclonal Anti-PRAMEF1 Antibody


Product Datasheet for 'TA331764'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PRAMEF1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRAMEF1. Synthetic peptide located within the following region: GAWALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name PRAME family member 1
Background This gene is a member of the PRAME (preferentially expressed antigen of melanoma) gene family which is expressed in many cancers but may function in reproductive tissues during development.
Synonyms dJ1198H6.1; RP5-845O24.1
Note Immunogen sequence homology: Human: 100%
Reference Data
Other products for "PRAMEF1"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies