PDZD3 Rabbit Polyclonal Antibody

SKU TA331732

Rabbit Polyclonal Anti-PDZD3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PDZD3 Antibody is: synthetic peptide directed towards the N-terminal region of Human PDZD3. Synthetic peptide located within the following region: PDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: PDZ domain containing 3
• Database Link:
  NP_079067
  Q86UT5
• Background: Guanylyl cyclase C (GCC, or GUCY2C; MIM 601330) produces cGMP following the binding of either endogenous ligands or heat-stable enterotoxins secreted by E. coli and other enteric bacteria. Activation of GCC initiates a signaling cascade that leads to phosphorylation of the cystic fibrosis transmembrane conductance regulator (CFTR; MIM 602421), followed by a net efflux of ions and water into the intestinal lumen. IKEPP is a regulatory protein that associates with GCC and regulates the amount of cGMP produced following receptor stimulation.
• Synonyms: IKEPP; NHERF4; PDZK2
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 86%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome