HDHD5 Rabbit Polyclonal Antibody

SKU TA331687

Rabbit Polyclonal Anti-CECR5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CECR5 Antibody is: synthetic peptide directed towards the C-terminal region of Human CECR5. Synthetic peptide located within the following region: SQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: cat eye syndrome chromosome region, candidate 5
• Database Link:
  NP_149061
  Q9BXW7
• Background: The function of this protein remains unknown.
• Synonyms: candidate 5; cat eye syndrome chromosome region
• Note: Immunogen sequence homology: Human: 100%

Reference Data