HDHD5 Rabbit Polyclonal Antibody

CAT#: TA331687

Rabbit Polyclonal Anti-CECR5 Antibody

Product Images

Host: Rabbit; Target Name: CECR5; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CECR5 Antibody is: synthetic peptide directed towards the C-terminal region of Human CECR5. Synthetic peptide located within the following region: SQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: cat eye syndrome chromosome region, candidate 5
• Database Link:
  NP_149061
  Entrez Gene 27440 Human
  UniProt ID Q9BXW7
• Background: The function of this protein remains unknown.
• Synonyms: candidate 5; cat eye syndrome chromosome region
• Note: Immunogen sequence homology: Human: 100%