SPSB3 Rabbit Polyclonal Antibody

SKU TA331672

Rabbit Polyclonal Anti-SPSB3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPSB3 Antibody is: synthetic peptide directed towards the C-terminal region of Human SPSB3. Synthetic peptide located within the following region: PGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: splA/ryanodine receptor domain and SOCS box containing 3
• Database Link:
  NP_543137
  Q6PJ21
• Background: SPSB3 may be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
• Synonyms: C16orf31; SSB3
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome