OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTRFR Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA331630
Rabbit Polyclonal Anti-C12orf65 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407691 Transient overexpression lysate of chromosome 12 open reading frame 65 (C12orf65), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP309162 Recombinant protein of human chromosome 12 open reading frame 65 (C12orf65), transcript variant 1, 20 µg
20 ug
$867.00

View other "MTRFR or NM_152269" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-C12orf65 Antibody is: synthetic peptide directed towards the C-terminal region of Human C12orf65. Synthetic peptide located within the following region: HIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 18 kDa
Gene Name chromosome 12 open reading frame 65
Database Link
Background This nuclear gene encodes a mitochondrial matrix protein that appears to contribute to peptide chain termination in the mitochondrial translation machinery. Two different 1 bp deletions (resulting in the same premature stop codon)result in decreased mitochondrial translation, decreased levels of oxidative phosphorylation complexes and encepthalomyopathy. Alternative splicing results in multiple transcript variants.
Synonyms COXPD7; SPG55
Note Immunogen sequence homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 92%; Horse: 86%; Dog: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Categories Intracellular Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products