PM20D1 Rabbit Polyclonal Antibody

CAT#: TA331624

Rabbit Polyclonal Anti-PM20D1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of peptidase M20 domain containing 1 (PM20D1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human peptidase M20 domain containing 1 (PM20D1), 20 µg
    • 20 ug

USD 867.00

Other products for "PM20D1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PM20D1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PM20D1. Synthetic peptide located within the following region: SMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name peptidase M20 domain containing 1
Background The function of this protein remains unknown.
Synonyms Cps1
Note Immunogen sequence homology: Human: 100%; Pig: 91%; Guinea pig: 91%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.