CBWD2 Rabbit Polyclonal Antibody

SKU TA331603

Rabbit Polyclonal Anti-CBWD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CBWD2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CBWD2. Synthetic peptide located within the following region: DNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDDTERTNR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: COBW domain containing 2
• Database Link:
  NP_742000
  Q8IUF1
• Background: The function of this protein remains unknown.
• Synonyms: COBW domain-containing protein 2; COBW domain containing 2
• Note: Immunogen sequence homology: Human: 100%; Bovine: 93%; Rat: 92%; Mouse: 92%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data