OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRSS36 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA331597
Rabbit Polyclonal Anti-PRSS36 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "PRSS36 or NM_173502" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PRSS36 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRSS36. Synthetic peptide located within the following region: HLLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 94 kDa
Gene Name protease, serine 36
Database Link
Background PRSS36 is a Serine protease. It hydrolyzes the peptides N-t-Boc-Gln- Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC and, to a lesser extent, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Val-Leu-Lys-AMC. It has a preference for substrates with an Arg instead of a Lys residue in position P1.
Synonyms FLJ90661
Note Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Yeast: 89%; Mouse: 86%; Rat: 85%; Rabbit: 85%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Categories Enzyme: Peptidases, Secreated Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products