CD300LB Rabbit Polyclonal Antibody

CAT#: TA331590

Rabbit Polyclonal Anti-CD300LB Antibody


 Product Datasheet for 'TA331590'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-CD300LB Antibody is: synthetic peptide directed towards the middle region of Human CD300LB. Synthetic peptide located within the following region: CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 26 kDa
Gene Name CD300 molecule like family member b
Background CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells.
Synonyms CD300b; CLM-7; CLM7; CMRF35-A2; IREM-3; IREM3; TREM-5; TREM5
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
Other products for "CD300LB"
Frequently bought together (2)
Transient overexpression lysate of CD300 molecule-like family member b (CD300LB)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones