LONRF2 Rabbit Polyclonal Antibody

CAT#: TA331527

Rabbit Polyclonal Anti-LONRF2 Antibody

Product Images

WB Suggested Anti-LONRF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LONRF2 Antibody: synthetic peptide directed towards the middle region of human LONRF2. Synthetic peptide located within the following region: IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: LON peptidase N-terminal domain and ring finger 2
• Database Link:
  NP_940863
  Entrez Gene 164832 Human
  UniProt ID Q1L5Z9
• Background: LONRF2 contains 1 Lon domain,1 RING-type zinc finger and 6 TPR repeats. The function of the LONRF2 protein remains unknown.
• Synonyms: RNF192
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 90%; Rabbit: 90%; Guinea pig: 90%

Reference Data

• Protein Families: Druggable Genome