TBC1D9B Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Transient overexpression lysate of TBC1 domain family, member 9B (with GRAM domain) (TBC1D9B), transcript variant 2
USD 665.00
Other products for "TBC1D9B"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TBC1D9B Antibody is: synthetic peptide directed towards the C-terminal region of Human TBC1D9B. Synthetic peptide located within the following region: SFEQILASILTESVLVNFFEKRVDIGLKIKDQKKVERQFSTASDHEQPGV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 43 kDa |
Gene Name | TBC1 domain family member 9B |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | GRAMD9B |
Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.