ZFP64 Rabbit Polyclonal Antibody

SKU TA331506

Rabbit Polyclonal Anti-ZFP64 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZFP64 Antibody: synthetic peptide directed towards the N terminal of human ZFP64. Synthetic peptide located within the following region: YLPTESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: ZFP64 zinc finger protein
• Database Link:
  NP_955459
  Q9NTW7
• Background: ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZFP64 may be involved in transcriptional regulation.
• Synonyms: ZNF338
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%; Mouse: 85%

Reference Data

• Protein Families: Transcription Factors