GFRAL Rabbit Polyclonal Antibody

SKU TA331490

Rabbit Polyclonal Anti-GFRAL Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: GDNF family receptor alpha like
• Database Link:
  NP_997293
  Q6UXV0
• Background: The function of this protein remains unknown.
• Synonyms: bA360D14.1; C6orf144; GRAL; UNQ9356
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 92%; Bovine: 85%; Pig: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane