CSPP1 Rabbit Polyclonal Antibody

SKU TA331390

Rabbit Polyclonal Anti-CSPP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CSPP1 antibody is: synthetic peptide directed towards the N-terminal region of Human CSPP1. Synthetic peptide located within the following region: AEDKAELESDPPYMEMKGKLSAKLSENSKILISMAKENIPPNSQQTRGSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 96 kDa
• Gene Name: centrosome and spindle pole associated protein 1
• Database Link:
  NP_079066
  Q1MSJ5
• Background: CSPP1 interacts with centrosomes and microtubules and plays a role in cell-cycle progression and spindle organization.
• Synonyms: CSPP; JBTS21
• Note: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 90%; Dog: 86%

Reference Data