TOR1AIP2 Rabbit Polyclonal Antibody

CAT#: TA331367

Rabbit Polyclonal Anti-TOR1AIP2 Antibody

Product Images

WB Suggested Anti-TOR1AIP2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TOR1AIP2 antibody is: synthetic peptide directed towards the N-terminal region of Human TOR1AIP2. Synthetic peptide located within the following region: PDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: torsin 1A interacting protein 2
• Database Link:
  NP_659471
  Entrez Gene 163590 Human
  UniProt ID Q9H496
• Background: TOR1AIP2 regulates the distribution of TOR1A between the endoplasmic reticulum and the nuclear envelope.
• Synonyms: IFRG15; LULL1; NET9
• Note: Rat: 100%; Human: 100%; Yeast: 100%; Dog: 83%; Horse: 79%

Reference Data

• Protein Families: Transmembrane