Akirin2 Rabbit Polyclonal Antibody

CAT#: TA331307

Rabbit Polyclonal Anti-Akirin2 Antibody

Product Images

Host: Rabbit; Target Name: Akirin2; Sample Tissue: Mouse Spleen lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Akirin2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Akirin2. Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: akirin 2
• Database Link:
  NP_001007590
  Entrez Gene 433693 Mouse
  UniProt ID B1AXD8
• Background: Akirin2 forms a complex with YWHAB that acts to repress transcription of DUSP1. It is required for embryonic development and the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6.
• Synonyms: C6orf166; dJ486L4.2; FBI1; FLJ10342
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%