RTN4RL2 Rabbit Polyclonal Antibody

SKU TA331292

Rabbit Polyclonal Anti-RTN4RL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RTN4RL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RTN4RL2. Synthetic peptide located within the following region: DYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: reticulon 4 receptor-like 2
• Database Link:
  NP_848665
  Q86UN3
• Background: RTN4RL2 may play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
• Synonyms: NgR2; NGRH1
• Note: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome