MDGA2 Rabbit Polyclonal Antibody

SKU TA331269

Rabbit Polyclonal Anti-MDGA2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MDGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human MDGA2. Synthetic peptide located within the following region: TATRNTKYTPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 81 kDa
• Gene Name: MAM domain containing glycosylphosphatidylinositol anchor 2
• Database Link:
  NP_878250
  Q7Z553
• Background: MDGA2 may involved in cell-cell interactions.
• Synonyms: c14_5286; MAMDC1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane