EXOC3L2 Rabbit Polyclonal Antibody

CAT#: TA331251

Rabbit Polyclonal Anti-EXOC3L2 Antibody

Product Images

WB Suggested Anti-EXOC3L2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EXOC3L2 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOC3L2. Synthetic peptide located within the following region: GAQALALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: exocyst complex component 3-like 2
• Database Link:
  NP_612635
  Entrez Gene 90332 Human
  UniProt ID Q2M3D2
• Background: The function of this protein remains unknown.
• Synonyms: XTP7
• Note: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%