Ap1s1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Ap1s1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ap1s1. Synthetic peptide located within the following region: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 19 kDa |
| Gene Name | adaptor protein complex AP-1, sigma 1 |
| Database Link | |
| Background | Ap1s1 is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. |
| Synonyms | AP19; CLAPS1; FLJ92436; OTTHUMP00000211468; SIGMA1A; Sigma1A-adaptin; WUGSC:H_DJ0747G18.2 |
| Note | Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
BIG1/Arfgef1 and Arf1 regulate the initiation of myelination by Schwann cells in mice
Miyamoto, Torii, Tago et al
Sci Adv (2018) 4 (4), eaar4471 DOI: 10.1126/sciadv.aar4471
Miyamoto, Torii, Tago et al
Sci Adv (2018) 4 (4), eaar4471 DOI: 10.1126/sciadv.aar4471
Cited by 46
AI Summary: In this study, OriGene products—specifically the Arfgef1 (NM_001161796) and Arf1 (NM_007481) shRNA plasmids—were used to knock down gene expression in Schwann cells, enabling the authors to investigate the roles of BIG1/Arfgef1 and Arf1 in regulating the initiation of myelination in mice.
BIG1/Arfgef1 and Arf1 regulate the initiation of myelination by Schwann cells in mice
Miyamoto, Torii, Tago et al
Sci. Adv. (2018) 4 (4), eaar4471 DOI: 10.1126/sciadv.aar4471
Miyamoto, Torii, Tago et al
Sci. Adv. (2018) 4 (4), eaar4471 DOI: 10.1126/sciadv.aar4471
AI Summary: OriGene’s rabbit polyclonal anti-AP1S1 antibody (cat. no. TA331243) was used in this study to detect AP1S1 protein by immunoblotting, contributing to the analysis of protein localization and expression involved in Schwann cell myelination.
Snippet: rabbit polyclonal anti-AP1S1 (cat. no. TA331243;IB, 1/500) from Origene;and mouse monoclonal anti-Arf1 (cat. no. sc-53168;IB, 1/50), mouse monoclonal anti-Arf6 (cat. no. sc-7971;IB, 1/25), rabbit polyclonal anti-AP1B1 (cat. no. sc-10762;IB, 1/100), mouse monoclonal anti-COPB1/COPB (cat. no. sc-393615;IB, 1/100;IP, 1 μg per lysate)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
