SYNRG Rabbit Polyclonal Antibody

CAT#: TA331234

Rabbit Polyclonal Anti-SYNRG Antibody

Product Images

WB Suggested Anti-SYNRG Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SYNRG antibody is: synthetic peptide directed towards the N-terminal region of Human SYNRG. Synthetic peptide located within the following region: QQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 119 kDa
• Gene Name: synergin, gamma
• Database Link:
  NP_001157019
  Entrez Gene 11276 Human
  UniProt ID Q9UMZ2
• Background: This gene encodes a protein that interacts with the gamma subunit of AP1 clathrin-adaptor complex. The AP1 complex is located at the trans-Golgi network and associates specific proteins with clathrin-coated vesicles. This encoded protein may act to connect the AP1 complex to other proteins. Alternatively spliced transcript variants that encode different isoforms have been described for this gene.
• Synonyms: AP1GBP1; SYNG
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 93%; Guinea pig: 93%