Smad4 Rabbit Polyclonal Antibody

SKU TA331109

Rabbit Polyclonal Anti-Smad4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Smad4 antibody: synthetic peptide directed towards the middle region of human Smad4. Synthetic peptide located within the following region: YVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATST
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: SMAD family member 4
• Database Link:
  NP_032566
  P97471
• Background: The function of Smad4 remains unknown.
• Synonyms: DPC4; hSMAD4; JIP; MADH4; OTTHUMP00000163548
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85%

Reference Data