PCDHB14 Rabbit Polyclonal Antibody

SKU TA331067

Rabbit polyclonal Anti-PCDHB14 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCDHB14 antibody is: synthetic peptide directed towards the middle region of Human PCDHB14. Synthetic peptide located within the following region: YGKISYTFFHASEDIRKTFEINPISGEVNLRSPLDFEVIQSYTINIQATD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: protocadherin beta 14
• Database Link:
  NP_061757
  Q9Y5E9
• Background: The function of this protein remains unknown.
• Synonyms: PCDH-BETA14
• Note: Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane