ALG1 Rabbit Polyclonal Antibody

CAT#: TA331033

Rabbit polyclonal Anti-ALG1 Antibody

Product Images

Host: Rabbit; Target Name: ALG1; Sample Tissue: Uterus Tumor lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ALG1 antibody is: synthetic peptide directed towards the C-terminal region of Human ALG1. Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
• Database Link:
  NP_061982
  Entrez Gene 56052 Human
  UniProt ID Q9BT22
• Background: The function of this protein remains unknown.
• Synonyms: CDG1K; hMat-1; HMAT1; HMT-1; HMT1; Mat-1; MT-1
• Note: Human: 100%; Dog: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Mouse: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis