OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Uap1l1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA331025
Rabbit polyclonal Anti-Uap1l1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Uap1l1 or NM_001033293" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Uap1l1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KVPYVDEEGNLVKPLRPNGIKMEKFVFDVFQFAKNFVAFEVCREEEFSPL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 56 kDa
Gene Name UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
Database Link
Background The function of this protein remains unknown.
Synonyms UAP1L1
Note Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Zebrafish: 83%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Metabolic Remodeling During the Early Phase of Spontaneous Seizure Emergence Highlights Hexosamine Biosynthetic Pathway Dysregulation in Temporal Lobe Epilepsy
Zhao, Zhang, Xu et al
J Neurochem (2025) 169 (12), e70314 DOI: 10.1111/jnc.70314
Cited by 1
AI Summary: OriGene's anti-UAP1L1 antibody (cat. no. TA331025) was used in this study to detect and validate the expression of UAP1L1 protein, contributing to the identification of hexosamine biosynthetic pathway dysregulation in temporal lobe epilepsy.
Snippet: anti-GFPT1 (Abcam, USA, cat. no. ab125069, 1:500, RRID:AB_2109646), anti-UAP1L1 (Origene, USA, cat. no. TA331025, 1:500), anti-OGA (ProteinTech, China, cat. no. 14711-1-AP, 1:8000, RRID:AB_2143063)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products