GLT6D1 Rabbit Polyclonal Antibody

CAT#: TA331015

Rabbit polyclonal Anti-GLT6D1 Antibody

Product Images

WB Suggested Anti-GLT6D1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLT6D1 antibody: synthetic peptide directed towards the middle region of human GLT6D1. Synthetic peptide located within the following region: FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: glycosyltransferase 6 domain containing 1
• Database Link:
  NP_892019
  Entrez Gene 360203 Human
  UniProt ID Q7Z4J2
• Background: GLT6D1 is a single-pass type II membrane protein. It belongs to the glycosyltransferase 6 family. The exact function of GLT6D1 remains unknown.
• Synonyms: GLTDC1; GT6M7
• Note: Human: 100%; Horse: 90%; Bovine: 90%; Pig: 86%; Rat: 77%