FYN Rabbit Polyclonal Antibody

CAT#: TA330931

Rabbit polyclonal Anti-FYN Antibody

Product Images

WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human heart

• 

  Host: Rabbit; Target Name: FYN; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: FYN; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: FYN; Sample Tissue: 293T; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FYN antibody: synthetic peptide directed towards the N terminal of human FYN. Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: FYN proto-oncogene, Src family tyrosine kinase
• Database Link:
  NP_694593
  Entrez Gene 2534 Human
  UniProt ID P06241
• Background: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.
• Synonyms: p59-FYN; SLK; SYN
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis