CCDC85C Rabbit Polyclonal Antibody

SKU TA330858

Rabbit Polyclonal Anti-CCDC85C Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCDC85C antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC85C. Synthetic peptide located within the following region: HLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: coiled-coil domain containing 85C
• Database Link:
  NP_001138467
  A6NKD9
• Background: CCDC85C may play an important role in cortical development, especially in the maintenance of radial glia.
• Synonyms: FLJ22558; MGC117455
• Note: Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 86%; Rabbit: 79%

Reference Data