OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC85C Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA330857
Rabbit Polyclonal Anti-CCDC85C Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY428630 Transient overexpression lysate of coiled-coil domain containing 85C (CCDC85C) (as WB positive control) 100 ug
$436.00
TP327995 Purified recombinant protein of Homo sapiens coiled-coil domain containing 85C (CCDC85C), 20 µg
20 ug
$737.00

View other "CCDC85C or NM_001144995" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CCDC85C antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC85C. Synthetic peptide located within the following region: HAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 46 kDa
Gene Name coiled-coil domain containing 85C
Database Link
Background CCDC85C may play an important role in cortical development, especially in the maintenance of radial glia.
Synonyms FLJ22558; MGC117455
Note Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

KLF7/VPS35 axis contributes to hepatocellular carcinoma progression through CCDC85C-activated β-catenin pathway
Guo, Chai, Jia et al
Cell Biosci (2021) 11 (1), 73 DOI: 10.1186/s13578-021-00585-6
Cited by 39
AI Summary: In this study, the OriGene anti-CCDC85C antibody (TA330857) was used to detect CCDC85C protein levels in hepatocellular carcinoma cells, contributing to the investigation of the KLF7/VPS35/CCDC85C/β-catenin signaling pathway in cancer progression.
Snippet: …The primary antibodies used as follow: anti-KLF7 (398576, Santa Cruz), anti-GAPDH (60004–1-Ig, Proteintech), anti-VPS35 (157220, Abcam), anti-CCDC85C (TA330857, ORIGENE), anti-active β-catenin (19807, Cell Signaling Technology), anti-β-actin (47778, Santa Cruz)
FigureFigureFigure
WB IHC IP ChIP
KLF7/VPS35 Axis Contributes to Hepatocellular Carcinoma Progression through CCDC85C-activated β Catenin Pathway
Guo, Chai, Jia et al
Research Square (2020)
Snippet: The primary antibodies used as follow: anti-KLF7 (398576, Santa Cruz), anti-GAPDH (60004-1-Ig, Proteintech), anti-VPS35 (157220, Abcam), anti-CCDC85C (TA330857, ORIGENE), anti-active β-catenin (19807, Cell Signaling Technology), anti-β-actin (47778, Santa;- The primary antibodies used as follow: anti-KLF7 (398576, Santa Cruz), anti-GAPDH (60004-1-Ig, Proteintech), anti-VPS35 (157220, Abcam), anti-CCDC85C (TA330857, ORIGENE), anti-active β-catenin (19807, Cell Signaling Technology), anti-β-actin (47778, Santa
IP ChIP
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products