SOHLH2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-SOHLH2 antibody is: synthetic peptide directed towards the N-terminal region of Human SOHLH2. Synthetic peptide located within the following region: MSQGSGLHQVSKRQQVDQLPRMQENLVKTLLLKEELDPLKAKIDILLVGD |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 55 kDa |
| Gene Name | spermatogenesis and oogenesis specific basic helix-loop-helix 2 |
| Database Link | |
| Background | SOHLH2 is the probable transcription factor, which may be involved in spermatogenesis and oogenesis. |
| Synonyms | bHLHe81; SOSF2; SPATA28; TEB1 |
| Note | Human: 100%; Dog: 92%; Pig: 83%; Rat: 83%; Guinea pig: 83% |
| Reference Data | |
| Protein Families | Transcription Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Depletion of follicles accelerated by combined exposure to phthalates and 4-vinylcyclohexene diepoxide, leading to premature ovarian failure in rats
Tran, Jung, Yoo et al
Reprod Toxicol (2018) 80, 60-67 DOI: 10.1016/j.reprotox.2018.06.071
Tran, Jung, Yoo et al
Reprod Toxicol (2018) 80, 60-67 DOI: 10.1016/j.reprotox.2018.06.071
Cited by 43
AI Summary: In this study, OriGene’s anti-AMH antibody (Cat# TA336343) was used to assess AMH protein expression levels, contributing to the evaluation of ovarian follicle depletion in rats exposed to phthalates and VCD.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
