ZNF772 Rabbit Polyclonal Antibody

SKU TA330838

Rabbit Polyclonal Anti-ZNF772 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF772 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF772. Synthetic peptide located within the following region: LAEHQETHPGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: zinc finger protein 772
• Database Link:
  NP_001137540
  Q68DY9
• Background: ZNF772 may be involved in transcriptional regulation.
• Synonyms: DKFZp686I1569
• Note: Horse: 100%; Human: 100%; Pig: 92%; Rat: 92%; Rabbit: 91%; Zebrafish: 91%; Dog: 86%; Mouse: 83%; Bovine: 83%; Guinea pig: 77%

Reference Data